Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.45: ClpS-like [54735] (1 superfamily) beta-alpha(2)-beta-alpha-beta; 2 layers, alpha/beta |
Superfamily d.45.1: ClpS-like [54736] (3 families) |
Family d.45.1.0: automated matches [191583] (1 protein) not a true family |
Protein automated matches [191039] (4 species) not a true protein |
Species Caulobacter vibrioides [TaxId:155892] [188871] (2 PDB entries) |
Domain d3g3pb_: 3g3p B: [176328] automated match to d1mbuc_ complexed with mg; mutant |
PDB Entry: 3g3p (more details), 1.48 Å
SCOPe Domain Sequences for d3g3pb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3g3pb_ d.45.1.0 (B:) automated matches {Caulobacter vibrioides [TaxId: 155892]} pslyrvlilnddytpaefvvyvlerffnksredatrimlhvhqngvgvcgvytyevaetk vaqvidsarrhqhplqctmekd
Timeline for d3g3pb_: