Lineage for d3g3pa_ (3g3p A:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2553479Fold d.45: ClpS-like [54735] (1 superfamily)
    beta-alpha(2)-beta-alpha-beta; 2 layers, alpha/beta
  4. 2553480Superfamily d.45.1: ClpS-like [54736] (3 families) (S)
  5. 2553545Family d.45.1.0: automated matches [191583] (1 protein)
    not a true family
  6. 2553546Protein automated matches [191039] (4 species)
    not a true protein
  7. 2553564Species Caulobacter vibrioides [TaxId:155892] [188871] (2 PDB entries)
  8. 2553567Domain d3g3pa_: 3g3p A: [176327]
    automated match to d1mbuc_
    complexed with mg; mutant

Details for d3g3pa_

PDB Entry: 3g3p (more details), 1.48 Å

PDB Description: the structure of the m53a mutant of the caulobacter crescentus clps in complex with a peptide containing an amino-terminal norleucine residue
PDB Compounds: (A:) ATP-dependent Clp protease adapter protein clpS

SCOPe Domain Sequences for d3g3pa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3g3pa_ d.45.1.0 (A:) automated matches {Caulobacter vibrioides [TaxId: 155892]}
pslyrvlilnddytpaefvvyvlerffnksredatrimlhvhqngvgvcgvytyevaetk
vaqvidsarrhqhplqctmekd

SCOPe Domain Coordinates for d3g3pa_:

Click to download the PDB-style file with coordinates for d3g3pa_.
(The format of our PDB-style files is described here.)

Timeline for d3g3pa_: