SCOP 1.75: Domain d6gswb1: 6gsw B:85-217

Lineage for d6gswb1 (6gsw B:85-217)

1. Root: SCOP 1.75

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.45: GST C-terminal domain-like [47615] (1 superfamily)
   core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix

4. Superfamily a.45.1: GST C-terminal domain-like [47616] (2 families)
   this domains follows the thioredoxin-like N-terminal domain

5. Family a.45.1.1: Glutathione S-transferase (GST), C-terminal domain [47617] (18 proteins)

6. Protein Class mu GST [81348] (3 species)

7. Species Rat (Rattus norvegicus) [TaxId:10116] [47623] (16 PDB entries)

8. Domain d6gswb1: 6gsw B:85-217 [17632]
   Other proteins in same PDB: d6gswa2, d6gswb2
   complexed with gps, so4; mutant

Details for d6gswb1

PDB Entry: 6gsw, 1.85 Å

PDB Description: first-sphere and second-sphere electrostatic effects in the active site of a class mu glutathione transferase

PDB Compounds: (B:) mu class glutathione s-transferase of isoenzyme 3-3

SCOP Domain Sequences for d6gswb1:

Sequence; same for both SEQRES and ATOM records:

>d6gswb1 a.45.1.1 (B:85-217) Class mu GST {Rat (Rattus norvegicus) [TaxId: 10116]}
lcgeteeeriradivenqvmdnrmqlimlcynpdfekqkpeflktipekmklyseflgkr
pwfagdkvtyvdflaydildqyhifepkcldafpnlkdflarfeglkkisaymkssryls
tpifsklaqwsnk

Timeline for d6gswb1:

• d6gswb1 first appeared (with stable ids) in SCOP 1.55
  
• d6gswb1 appears in SCOP 1.73
  
• d6gswb1 appears in SCOPe 2.01
  
• d6gswb1 appears in the current release, SCOPe 2.08