Lineage for d3g2za_ (3g2z A:)

  1. Root: SCOPe 2.03
  2. 1449807Class e: Multi-domain proteins (alpha and beta) [56572] (66 folds)
  3. 1450060Fold e.3: beta-lactamase/transpeptidase-like [56600] (1 superfamily)
    contains a cluster of helices and an alpha+beta sandwich
  4. 1450061Superfamily e.3.1: beta-lactamase/transpeptidase-like [56601] (4 families) (S)
  5. 1450062Family e.3.1.1: beta-Lactamase/D-ala carboxypeptidase [56602] (19 proteins)
  6. 1450662Protein automated matches [190161] (19 species)
    not a true protein
  7. 1450707Species Escherichia coli [TaxId:562] [187306] (39 PDB entries)
  8. 1450747Domain d3g2za_: 3g2z A: [176316]
    automated match to d1iysa_
    complexed with dms, gz2

Details for d3g2za_

PDB Entry: 3g2z (more details), 1.5 Å

PDB Description: ctx-m-9 class a beta-lactamase complexed with compound 2 (gz2)
PDB Compounds: (A:) Beta-lactamase CTX-M-9a

SCOPe Domain Sequences for d3g2za_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3g2za_ e.3.1.1 (A:) automated matches {Escherichia coli [TaxId: 562]}
tsavqqklaalekssggrlgvalidtadntqvlyrgderfpmcstskvmaaaavlkqset
qkqllnqpveikpadlvnynpiaekhvngtmtlaelsaaalqysdntamnkliaqlggpg
gvtafaraigdetfrldrteptlntaipgdprdtttpramaqtlrqltlghalgetqraq
lvtwlkgnttgaasiraglptswtagdktgsgdygttndiaviwpqgraplvlvtyftqp
qqnaesrrdvlasaariiaegl

SCOPe Domain Coordinates for d3g2za_:

Click to download the PDB-style file with coordinates for d3g2za_.
(The format of our PDB-style files is described here.)

Timeline for d3g2za_: