SCOPe 2.07: Domain d3g2xc1: 3g2x C:2-133

Lineage for d3g2xc1 (3g2x C:2-133)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.6: Nucleoside diphosphate kinase, NDK [54919] (2 families)

5. Family d.58.6.1: Nucleoside diphosphate kinase, NDK [54920] (2 proteins)

6. Protein automated matches [190032] (18 species)
   not a true protein

7. Species Acanthamoeba polyphaga mimivirus [TaxId:212035] [188891] (23 PDB entries)

8. Domain d3g2xc1: 3g2x C:2-133 [176310]
   Other proteins in same PDB: d3g2xc2, d3g2xe2
   automated match to d2b8pa1
   complexed with mg, tyd; mutant

Details for d3g2xc1

PDB Entry: 3g2x, 2.7 Å

PDB Description: structure of mimivirus ndk +kpn - n62l double mutant complexed with dtdp

PDB Compounds: (C:) Nucleoside diphosphate kinase

SCOPe Domain Sequences for d3g2xc1:

Sequence; same for both SEQRES and ATOM records:

>d3g2xc1 d.58.6.1 (C:2-133) automated matches {Acanthamoeba polyphaga mimivirus [TaxId: 212035]}
qrtlvlikpdaferslvaeimgriekknfkivsmkfwskaprnlieqhykehseqsyfnd
lcdfmvsgpiisivyegtdaiskirrlqgntnplasapgtirgdlandirenlihasdse
dsavdeisiwfp

Timeline for d3g2xc1:

• d3g2xc1 first appeared in SCOPe 2.01, called d3g2xc_
  
• d3g2xc1 appears in SCOPe 2.06
  
• d3g2xc1 appears in the current release, SCOPe 2.08