Lineage for d6gswa1 (6gsw A:85-217)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2712830Fold a.45: GST C-terminal domain-like [47615] (1 superfamily)
    core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix
  4. 2712831Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families) (S)
    this domains follows the thioredoxin-like N-terminal domain
  5. 2712832Family a.45.1.1: Glutathione S-transferase (GST), C-terminal domain [47617] (19 proteins)
  6. 2713057Protein Class mu GST [81348] (3 species)
  7. 2713121Species Norway rat (Rattus norvegicus) [TaxId:10116] [47623] (16 PDB entries)
  8. 2713122Domain d6gswa1: 6gsw A:85-217 [17631]
    Other proteins in same PDB: d6gswa2, d6gswb2
    complexed with gps, so4

Details for d6gswa1

PDB Entry: 6gsw (more details), 1.85 Å

PDB Description: first-sphere and second-sphere electrostatic effects in the active site of a class mu glutathione transferase
PDB Compounds: (A:) mu class glutathione s-transferase of isoenzyme 3-3

SCOPe Domain Sequences for d6gswa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6gswa1 a.45.1.1 (A:85-217) Class mu GST {Norway rat (Rattus norvegicus) [TaxId: 10116]}
lcgeteeeriradivenqvmdnrmqlimlcynpdfekqkpeflktipekmklyseflgkr
pwfagdkvtyvdflaydildqyhifepkcldafpnlkdflarfeglkkisaymkssryls
tpifsklaqwsnk

SCOPe Domain Coordinates for d6gswa1:

Click to download the PDB-style file with coordinates for d6gswa1.
(The format of our PDB-style files is described here.)

Timeline for d6gswa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d6gswa2