| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.118: alpha-alpha superhelix [48370] (28 superfamilies) multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix |
Superfamily a.118.9: ENTH/VHS domain [48464] (5 families) ![]() |
| Family a.118.9.2: VHS domain [48468] (6 proteins) |
| Protein automated matches [191107] (1 species) not a true protein |
| Species Human (Homo sapiens) [TaxId:9606] [189141] (5 PDB entries) |
| Domain d3g2wb_: 3g2w B: [176307] automated match to d1ujka_ |
PDB Entry: 3g2w (more details), 2.4 Å
SCOPe Domain Sequences for d3g2wb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3g2wb_ a.118.9.2 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
etlearinratnplnkeldwasingfceqlnedfegpplatrllahkiqspqeweaiqal
tvletcmkscgkrfhdevgkfrflnelikvvspkylgsrtsekvknkilellyswtvglp
eevkiaeayqmlkkqgiv
Timeline for d3g2wb_: