Lineage for d3g2va_ (3g2v A:)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1745105Fold a.118: alpha-alpha superhelix [48370] (24 superfamilies)
    multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
  4. 1746326Superfamily a.118.9: ENTH/VHS domain [48464] (5 families) (S)
  5. 1746335Family a.118.9.2: VHS domain [48468] (6 proteins)
  6. 1746374Protein automated matches [191107] (1 species)
    not a true protein
  7. 1746375Species Human (Homo sapiens) [TaxId:9606] [189141] (5 PDB entries)
  8. 1746380Domain d3g2va_: 3g2v A: [176304]
    automated match to d1ujka_
    complexed with iod

Details for d3g2va_

PDB Entry: 3g2v (more details), 2.1 Å

PDB Description: VHS Domain of human GGA1 complexed with Sotilin C-terminal Phosphopeptide
PDB Compounds: (A:) ADP-ribosylation factor-binding protein GGA1

SCOPe Domain Sequences for d3g2va_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3g2va_ a.118.9.2 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
petlearinratnplnkeldwasingfceqlnedfegpplatrllahkiqspqeweaiqa
ltvletcmkscgkrfhdevgkfrflnelikvvspkylgsrtsekvknkilellyswtvgl
peevkiaeayqmlkkqgivk

SCOPe Domain Coordinates for d3g2va_:

Click to download the PDB-style file with coordinates for d3g2va_.
(The format of our PDB-style files is described here.)

Timeline for d3g2va_: