![]() | Class a: All alpha proteins [46456] (284 folds) |
![]() | Fold a.118: alpha-alpha superhelix [48370] (24 superfamilies) multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix |
![]() | Superfamily a.118.9: ENTH/VHS domain [48464] (5 families) ![]() |
![]() | Family a.118.9.2: VHS domain [48468] (6 proteins) |
![]() | Protein automated matches [191107] (1 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [189141] (5 PDB entries) |
![]() | Domain d3g2ub_: 3g2u B: [176303] automated match to d1ujka_ complexed with iod |
PDB Entry: 3g2u (more details), 2.3 Å
SCOPe Domain Sequences for d3g2ub_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3g2ub_ a.118.9.2 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]} petlearinratnplnkeldwasingfceqlnedfegpplatrllahkiqspqeweaiqa ltvletcmkscgkrfhdevgkfrflnelikvvspkylgsrtsekvknkilellyswtvgl peevkiaeayqmlkkqgivk
Timeline for d3g2ub_: