Lineage for d3g2ta_ (3g2t A:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2338494Fold a.118: alpha-alpha superhelix [48370] (28 superfamilies)
    multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
  4. 2340111Superfamily a.118.9: ENTH/VHS domain [48464] (5 families) (S)
  5. 2340126Family a.118.9.2: VHS domain [48468] (6 proteins)
  6. 2340165Protein automated matches [191107] (1 species)
    not a true protein
  7. 2340166Species Human (Homo sapiens) [TaxId:9606] [189141] (5 PDB entries)
  8. 2340169Domain d3g2ta_: 3g2t A: [176300]
    automated match to d1ujka_
    complexed with iod

Details for d3g2ta_

PDB Entry: 3g2t (more details), 2 Å

PDB Description: VHS Domain of human GGA1 complexed with SorLA C-terminal Phosphopeptide
PDB Compounds: (A:) ADP-ribosylation factor-binding protein GGA1

SCOPe Domain Sequences for d3g2ta_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3g2ta_ a.118.9.2 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
petlearinratnplnkeldwasingfceqlnedfegpplatrllahkiqspqeweaiqa
ltvletcmkscgkrfhdevgkfrflnelikvvspkylgsrtsekvknkilellyswtvgl
peevkiaeayqmlkkqgivk

SCOPe Domain Coordinates for d3g2ta_:

Click to download the PDB-style file with coordinates for d3g2ta_.
(The format of our PDB-style files is described here.)

Timeline for d3g2ta_: