SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d3g2ja_ (3g2j A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2142044Fold c.87: UDP-Glycosyltransferase/glycogen phosphorylase [53755] (1 superfamily)
    consists of two non-similar domains with 3 layers (a/b/a) each
    domain 1: parallel beta-sheet of 7 strands, order 3214567
    domain 2: parallel beta-sheet of 6 strands, order 321456
  4. 2142045Superfamily c.87.1: UDP-Glycosyltransferase/glycogen phosphorylase [53756] (14 families) (S)
  5. 2142109Family c.87.1.4: Oligosaccharide phosphorylase [53766] (3 protein domains)
    automatically mapped to Pfam PF00343
  6. 2142250Protein automated matches [190111] (3 species)
    not a true protein
  7. 2142266Species Rabbit (Oryctolagus cuniculus) [TaxId:9986] [187274] (115 PDB entries)
  8. 2142342Domain d3g2ja_: 3g2j A: [176294]
    automated match to d1e1ya_
    complexed with 9gp

Details for d3g2ja_

PDB Entry: 3g2j (more details), 2.14 Å

PDB Description: Crystal structure of 1-(beta-D-glucopyranosyl)-4-substituted-1,2,3-triazoles in complex with glycogen phosphorylase
PDB Compounds: (A:) Glycogen phosphorylase, muscle form

SCOPe Domain Sequences for d3g2ja_:

Sequence, based on SEQRES records: (download)

>d3g2ja_ c.87.1.4 (A:) automated matches {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]}
qisvrglagvenvtelkknfnrhlhftlvkdrnvatprdyyfalahtvrdhlvgrwirtq
qhyyekdpkriyylslefymgrtlqntmvnlalenacdeatyqlgldmeeleeieedagl
gngglgrlaacfldsmatlglaaygygiryefgifnqkicggwqmeeaddwlrygnpwek
arpeftlpvhfygrvehtsqgakwvdtqvvlampydtpvpgyrnnvvntmrlwsakapnd
fnlkdfnvggyiqavldrnlaenisrvlypndnffegkelrlkqeyfvvaatlqdiirrf
ksskfgcrdpvrtnfdafpdkvaiqlndthpslaipelmrvlvdlerldwdkawevtvkt
caytnhtvlpealerwpvhlletllprhlqiiyeinqrflnrvaaafpgdvdrlrrmslv
eegavkrinmahlciagshavngvarihseilkktifkdfyelephkfqnktngitprrw
lvlcnpglaeiiaerigeeyisdldqlrkllsyvddeafirdvakvkqenklkfaayler
eykvhinpnslfdvqvkriheykrqllnclhvitlynrikkepnkfvvprtvmiggkaap
gyhmakmiiklitaigdvvnhdpvvgdrlrviflenyrvslaekvipaadlseqistagt
easgtgnmkfmlngaltigtmdganvemaeeageenffifgmrvedvdrldqrgynaqey
ydripelrqiieqlssgffspkqpdlfkdivnmlmhhdrfkvfadyeeyvkcqervsaly
knprewtrmvirniatsgkfssdrtiaqyareiwgvepsrqrlpa

Sequence, based on observed residues (ATOM records): (download)

>d3g2ja_ c.87.1.4 (A:) automated matches {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]}
qisvrglagvenvtelkknfnrhlhftlvkdrnvatprdyyfalahtvrdhlvgrwirtq
qhyyekdpkriyylslefymgrtlqntmvnlalenacdeatyqlgldmeeleeieedagl
gngglgrlaacfldsmatlglaaygygiryefgifnqkicggwqmeeaddwlrygnpwek
arpeftlpvhfygrvehtsqgakwvdtqvvlampydtpvpgyrnnvvntmrlwsakapnd
fnlgyiqavldrnlaenisrvlypndnffegkelrlkqeyfvvaatlqdiirrfksstnf
dafpdkvaiqlndthpslaipelmrvlvdlerldwdkawevtvktcaytnhtvlpealer
wpvhlletllprhlqiiyeinqrflnrvaaafpgdvdrlrrmslveegavkrinmahlci
agshavngvarihseilkktifkdfyelephkfqnktngitprrwlvlcnpglaeiiaer
igeeyisdldqlrkllsyvddeafirdvakvkqenklkfaaylereykvhinpnslfdvq
vkriheykrqllnclhvitlynrikkepnkfvvprtvmiggkaapgyhmakmiiklitai
gdvvnhdpvvgdrlrviflenyrvslaekvipaadlseqistagteasgtgnmkfmlnga
ltigtmdganvemaeeageenffifgmrvedvdrldqrgynaqeyydripelrqiieqls
sgffspkqpdlfkdivnmlmhhdrfkvfadyeeyvkcqervsalyknprewtrmvirnia
tsgkfssdrtiaqyareiwgvepsrqrlpa

SCOPe Domain Coordinates for d3g2ja_:

Click to download the PDB-style file with coordinates for d3g2ja_.
(The format of our PDB-style files is described here.)

Timeline for d3g2ja_: