SCOPe 2.05: Domain d2gsta1: 2gst A:85-217

Lineage for d2gsta1 (2gst A:85-217)

1. Root: SCOPe 2.05

2. Class a: All alpha proteins [46456] (286 folds)

3. Fold a.45: GST C-terminal domain-like [47615] (1 superfamily)
   core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix

4. Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families)
   this domains follows the thioredoxin-like N-terminal domain

5. Family a.45.1.1: Glutathione S-transferase (GST), C-terminal domain [47617] (19 proteins)

6. Protein Class mu GST [81348] (3 species)

7. Species Norway rat (Rattus norvegicus) [TaxId:10116] [47623] (16 PDB entries)

8. Domain d2gsta1: 2gst A:85-217 [17629]
   Other proteins in same PDB: d2gsta2, d2gstb2
   complexed with gps, so4

Details for d2gsta1

PDB Entry: 2gst, 1.8 Å

PDB Description: structure of the xenobiotic substrate binding site of a glutathione s- transferase as revealed by x-ray crystallographic analysis of product complexes with the diastereomers of 9-(s-glutathionyl)-10-hydroxy-9, 10-dihydrophenanthrene

PDB Compounds: (A:) glutathione s-transferase

SCOPe Domain Sequences for d2gsta1:

Sequence; same for both SEQRES and ATOM records:

>d2gsta1 a.45.1.1 (A:85-217) Class mu GST {Norway rat (Rattus norvegicus) [TaxId: 10116]}
lcgeteeeriradivenqvmdnrmqlimlcynpdfekqkpeflktipekmklyseflgkr
pwfagdkvtyvdflaydildqyhifepkcldafpnlkdflarfeglkkisaymkssryls
tpifsklaqwsnk

Timeline for d2gsta1:

• d2gsta1 first appeared (with stable ids) in SCOP 1.55
  
• d2gsta1 appears in SCOPe 2.04
  
• d2gsta1 appears in SCOPe 2.06
  
• d2gsta1 appears in the current release, SCOPe 2.08