Lineage for d2gsta1 (2gst A:85-217)

  1. Root: SCOP 1.63
  2. 208553Class a: All alpha proteins [46456] (171 folds)
  3. 213854Fold a.45: Glutathione S-transferase (GST), C-terminal domain [47615] (1 superfamily)
    core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix
  4. 213855Superfamily a.45.1: Glutathione S-transferase (GST), C-terminal domain [47616] (1 family) (S)
    this domains follows the thioredoxin-like N-terminal domain
  5. 213856Family a.45.1.1: Glutathione S-transferase (GST), C-terminal domain [47617] (15 proteins)
  6. 213954Protein Class mu GST [81348] (3 species)
  7. 213988Species Rat (Rattus norvegicus) [TaxId:10116] [47623] (14 PDB entries)
  8. 213989Domain d2gsta1: 2gst A:85-217 [17629]
    Other proteins in same PDB: d2gsta2, d2gstb2

Details for d2gsta1

PDB Entry: 2gst (more details), 1.8 Å

PDB Description: structure of the xenobiotic substrate binding site of a glutathione s- transferase as revealed by x-ray crystallographic analysis of product complexes with the diastereomers of 9-(s-glutathionyl)-10-hydroxy-9, 10-dihydrophenanthrene

SCOP Domain Sequences for d2gsta1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2gsta1 a.45.1.1 (A:85-217) Class mu GST {Rat (Rattus norvegicus)}
lcgeteeeriradivenqvmdnrmqlimlcynpdfekqkpeflktipekmklyseflgkr
pwfagdkvtyvdflaydildqyhifepkcldafpnlkdflarfeglkkisaymkssryls
tpifsklaqwsnk

SCOP Domain Coordinates for d2gsta1:

Click to download the PDB-style file with coordinates for d2gsta1.
(The format of our PDB-style files is described here.)

Timeline for d2gsta1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2gsta2