Lineage for d3g20a_ (3g20 A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2941191Fold d.24: Pili subunits [54522] (1 superfamily)
    contains very long N-terminal helix, which end is packed against beta-sheet
  4. 2941192Superfamily d.24.1: Pili subunits [54523] (8 families) (S)
    bacterial filament proteins
  5. 2941237Family d.24.1.3: Pseudopilin [117865] (2 proteins)
    automatically mapped to Pfam PF08334
  6. 2941242Protein automated matches [191070] (2 species)
    not a true protein
  7. 2941243Species Escherichia coli O157:H7 [TaxId:83334] [188977] (1 PDB entry)
  8. 2941244Domain d3g20a_: 3g20 A: [176286]
    automated match to d1t92a_
    complexed with ca, gol, na, nhe

Details for d3g20a_

PDB Entry: 3g20 (more details), 1.78 Å

PDB Description: crystal structure of the major pseudopilin from the type 2 secretion system of enterohaemorrhagic escherichia coli
PDB Compounds: (A:) Type II secretion protein

SCOPe Domain Sequences for d3g20a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3g20a_ d.24.1.3 (A:) automated matches {Escherichia coli O157:H7 [TaxId: 83334]}
slvvpnlmgnkdkadrqkvmsdlvalestldmyrldnnryptteqglralvskptvqpep
rnyrqdgyirrlpqdpwggdyqllnpgqysdidifspgpdgvpnteddignwtl

SCOPe Domain Coordinates for d3g20a_:

Click to download the PDB-style file with coordinates for d3g20a_.
(The format of our PDB-style files is described here.)

Timeline for d3g20a_: