SCOPe 2.08: Domain d3g20a_: 3g20 A:

Lineage for d3g20a_ (3g20 A:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.24: Pili subunits [54522] (1 superfamily)
   contains very long N-terminal helix, which end is packed against beta-sheet

4. Superfamily d.24.1: Pili subunits [54523] (8 families)
   bacterial filament proteins

5. Family d.24.1.3: Pseudopilin [117865] (2 proteins)
   automatically mapped to Pfam PF08334

6. Protein automated matches [191070] (2 species)
   not a true protein

7. Species Escherichia coli O157:H7 [TaxId:83334] [188977] (1 PDB entry)

8. Domain d3g20a_: 3g20 A: [176286]
   automated match to d1t92a_
   complexed with ca, gol, na, nhe

Details for d3g20a_

PDB Entry: 3g20, 1.78 Å

PDB Description: crystal structure of the major pseudopilin from the type 2 secretion system of enterohaemorrhagic escherichia coli

PDB Compounds: (A:) Type II secretion protein

SCOPe Domain Sequences for d3g20a_:

Sequence; same for both SEQRES and ATOM records:

>d3g20a_ d.24.1.3 (A:) automated matches {Escherichia coli O157:H7 [TaxId: 83334]}
slvvpnlmgnkdkadrqkvmsdlvalestldmyrldnnryptteqglralvskptvqpep
rnyrqdgyirrlpqdpwggdyqllnpgqysdidifspgpdgvpnteddignwtl

Timeline for d3g20a_:

• d3g20a_ first appeared in SCOPe 2.01
  
• d3g20a_ appears in SCOPe 2.07