Lineage for d3g1ya_ (3g1y A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2078560Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2079053Superfamily c.1.2: Ribulose-phoshate binding barrel [51366] (7 families) (S)
  5. 2079148Family c.1.2.3: Decarboxylase [51375] (4 protein domains)
  6. 2079288Protein automated matches [190130] (11 species)
    not a true protein
  7. 2079379Species Methanothermobacter thermautotrophicus [TaxId:187420] [188934] (67 PDB entries)
  8. 2079465Domain d3g1ya_: 3g1y A: [176284]
    automated match to d1dv7a_
    complexed with so4; mutant

Details for d3g1ya_

PDB Entry: 3g1y (more details), 1.4 Å

PDB Description: Crystal structure of the mutant D70N of orotidine 5'-monophosphate decarboxylase from Methanobacterium thermoautotrophicum complexed with sulfate
PDB Compounds: (A:) orotidine 5'-phosphate decarboxylase

SCOPe Domain Sequences for d3g1ya_:

Sequence, based on SEQRES records: (download)

>d3g1ya_ c.1.2.3 (A:) automated matches {Methanothermobacter thermautotrophicus [TaxId: 187420]}
rvdvmdvmnrlilamdlmnrddalrvtgevreyidtvkigyplvlsegmdiiaefrkrfg
criianfkvadipetnekicratfkagadaiivhgfpgadsvraclnvaeemgrevfllt
emshpgaemfiqgaadeiarmgvdlgvknyvgpstrperlsrlreiigqdsflispgvga
qggdpgetlrfadaiivgrsiyladnpaaaaagiiesi

Sequence, based on observed residues (ATOM records): (download)

>d3g1ya_ c.1.2.3 (A:) automated matches {Methanothermobacter thermautotrophicus [TaxId: 187420]}
rvdvmdvmnrlilamdlmnrddalrvtgevreyidtvkigyplvlsegmdiiaefrkrfg
criianfkvadipetnekicratfkagadaiivhgfpgadsvraclnvaeemgrevfllt
emshpgaemfiqgaadeiarmgvdlgvknyvgprperlsrlreiigqdsflispgetlrf
adaiivgrsiylpaaaaagiiesi

SCOPe Domain Coordinates for d3g1ya_:

Click to download the PDB-style file with coordinates for d3g1ya_.
(The format of our PDB-style files is described here.)

Timeline for d3g1ya_: