Lineage for d4gtuh1 (4gtu H:85-217)

  1. Root: SCOPe 2.03
  2. 1253684Class a: All alpha proteins [46456] (284 folds)
  3. 1270513Fold a.45: GST C-terminal domain-like [47615] (1 superfamily)
    core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix
  4. 1270514Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families) (S)
    this domains follows the thioredoxin-like N-terminal domain
  5. 1270515Family a.45.1.1: Glutathione S-transferase (GST), C-terminal domain [47617] (19 proteins)
  6. 1270721Protein Class mu GST [81348] (3 species)
  7. 1270729Species Human (Homo sapiens) [TaxId:9606] [47622] (16 PDB entries)
    Uniprot P09488 P28161
  8. 1270786Domain d4gtuh1: 4gtu H:85-217 [17628]
    Other proteins in same PDB: d4gtua2, d4gtub2, d4gtuc2, d4gtud2, d4gtue2, d4gtuf2, d4gtug2, d4gtuh2

Details for d4gtuh1

PDB Entry: 4gtu (more details), 3.3 Å

PDB Description: ligand-free homodimeric human glutathione s-transferase m4-4
PDB Compounds: (H:) glutathione s-transferase

SCOPe Domain Sequences for d4gtuh1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4gtuh1 a.45.1.1 (H:85-217) Class mu GST {Human (Homo sapiens) [TaxId: 9606]}
lcgeteeekirvdilenqamdvsnqlarvcyspdfeklkpeyleelptmmqhfsqflgkr
pwfvgdkitfvdflaydvldlhrifepncldafpnlkdfisrfeglekisaymkssrflp
kplytrvavwgnk

SCOPe Domain Coordinates for d4gtuh1:

Click to download the PDB-style file with coordinates for d4gtuh1.
(The format of our PDB-style files is described here.)

Timeline for d4gtuh1: