SCOPe 2.05: Domain d3g1ba_: 3g1b A:

Lineage for d3g1ba_ (3g1b A:)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.45: ClpS-like [54735] (1 superfamily)
   beta-alpha(2)-beta-alpha-beta; 2 layers, alpha/beta

4. Superfamily d.45.1: ClpS-like [54736] (3 families)

5. Family d.45.1.0: automated matches [191583] (1 protein)
   not a true family

6. Protein automated matches [191039] (1 species)
   not a true protein

7. Species Caulobacter vibrioides [TaxId:155892] [188871] (2 PDB entries)

8. Domain d3g1ba_: 3g1b A: [176248]
   automated match to d1mbuc_
   complexed with mg; mutant

Details for d3g1ba_

PDB Entry: 3g1b, 1.45 Å

PDB Description: the structure of the m53a mutant of caulobacter crescentus clps protease adaptor protein in complex with wlfvqrdske peptide

PDB Compounds: (A:) ATP-dependent Clp protease adapter protein clpS

SCOPe Domain Sequences for d3g1ba_:

Sequence; same for both SEQRES and ATOM records:

>d3g1ba_ d.45.1.0 (A:) automated matches {Caulobacter vibrioides [TaxId: 155892]}
lyrvlilnddytpaefvvyvlerffnksredatrimlhvhqngvgvcgvytyevaetkva
qvidsarrhqhplqctmekd

Timeline for d3g1ba_:

• d3g1ba_ first appeared in SCOPe 2.01
  
• d3g1ba_ appears in SCOPe 2.04
  
• d3g1ba_ appears in SCOPe 2.06
  
• d3g1ba_ appears in the current release, SCOPe 2.08