Lineage for d3g19a_ (3g19 A:)

  1. Root: SCOPe 2.02
  2. 1190016Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1202470Fold d.45: ClpS-like [54735] (1 superfamily)
    beta-alpha(2)-beta-alpha-beta; 2 layers, alpha/beta
  4. 1202471Superfamily d.45.1: ClpS-like [54736] (3 families) (S)
  5. 1202495Family d.45.1.2: Adaptor protein ClpS (YljA) [82641] (2 proteins)
  6. 1202516Protein automated matches [190034] (3 species)
    not a true protein
  7. 1202517Species Caulobacter vibrioides [TaxId:155892] [188665] (5 PDB entries)
  8. 1202522Domain d3g19a_: 3g19 A: [176245]
    automated match to d1mbuc_

Details for d3g19a_

PDB Entry: 3g19 (more details), 1.85 Å

PDB Description: The structure of the Caulobacter crescentus clpS protease adaptor protein in complex with LLL tripeptide
PDB Compounds: (A:) ATP-dependent Clp protease adapter protein clpS

SCOPe Domain Sequences for d3g19a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3g19a_ d.45.1.2 (A:) automated matches {Caulobacter vibrioides [TaxId: 155892]}
qkpslyrvlilnddytpmefvvyvlerffnksredatrimlhvhqngvgvcgvytyevae
tkvaqvidsarrhqhplqctmekd

SCOPe Domain Coordinates for d3g19a_:

Click to download the PDB-style file with coordinates for d3g19a_.
(The format of our PDB-style files is described here.)

Timeline for d3g19a_: