SCOPe 2.01: Domain d3g19a_: 3g19 A:

Lineage for d3g19a_ (3g19 A:)

1. Root: SCOPe 2.01

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.45: ClpS-like [54735] (1 superfamily)
   beta-alpha(2)-beta-alpha-beta; 2 layers, alpha/beta

4. Superfamily d.45.1: ClpS-like [54736] (3 families)

5. Family d.45.1.2: Adaptor protein ClpS (YljA) [82641] (2 proteins)

6. Protein automated matches [190034] (3 species)
   not a true protein

7. Species Caulobacter vibrioides [TaxId:155892] [188665] (5 PDB entries)

8. Domain d3g19a_: 3g19 A: [176245]
   automated match to d1mbuc_

Details for d3g19a_

PDB Entry: 3g19, 1.85 Å

PDB Description: The structure of the Caulobacter crescentus clpS protease adaptor protein in complex with LLL tripeptide

PDB Compounds: (A:) ATP-dependent Clp protease adapter protein clpS

SCOPe Domain Sequences for d3g19a_:

Sequence; same for both SEQRES and ATOM records:

>d3g19a_ d.45.1.2 (A:) automated matches {Caulobacter vibrioides [TaxId: 155892]}
qkpslyrvlilnddytpmefvvyvlerffnksredatrimlhvhqngvgvcgvytyevae
tkvaqvidsarrhqhplqctmekd

Timeline for d3g19a_:

• d3g19a_ is new in SCOPe 2.01-stable
  
• d3g19a_ appears in SCOPe 2.02
  
• d3g19a_ appears in the current release, SCOPe 2.08