Lineage for d3g0wa_ (3g0w A:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2008476Fold a.123: Nuclear receptor ligand-binding domain [48507] (1 superfamily)
    multihelical; 3 layers or orthogonally packed helices
  4. 2008477Superfamily a.123.1: Nuclear receptor ligand-binding domain [48508] (2 families) (S)
  5. 2008478Family a.123.1.1: Nuclear receptor ligand-binding domain [48509] (34 protein domains)
  6. 2008479Protein Androgen receptor [63621] (4 species)
  7. 2008552Species Norway rat (Rattus norvegicus) [TaxId:10116] [63622] (6 PDB entries)
  8. 2008553Domain d3g0wa_: 3g0w A: [176241]
    automated match to d1e3ga_
    protein/DNA complex; complexed with lgb

Details for d3g0wa_

PDB Entry: 3g0w (more details), 1.95 Å

PDB Description: Crystal structure of the rat androgen receptor ligand binding domain complex with an n-aryl-oxazolidin 2-imine inhibitor
PDB Compounds: (A:) Androgen receptor

SCOPe Domain Sequences for d3g0wa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3g0wa_ a.123.1.1 (A:) Androgen receptor {Norway rat (Rattus norvegicus) [TaxId: 10116]}
qpiflnvleaiepgvvcaghdnnqpdsfaallsslnelgerqlvhvvkwakalpgfrnlh
vddqmaviqyswmglmvfamgwrsftnvnsrmlyfapdlvfneyrmhksrmysqcvrmrh
lsqefgwlqitpqeflcmkalllfsiipvdglknqkffdelrmnyikeldriiackrknp
tscsrrfyqltklldsvqpiarelhqftfdllikshmvsvdfpemmaeiisvqvpkilsg
kvkpiyfht

SCOPe Domain Coordinates for d3g0wa_:

Click to download the PDB-style file with coordinates for d3g0wa_.
(The format of our PDB-style files is described here.)

Timeline for d3g0wa_: