SCOPe 2.05: Domain d3g0ma_: 3g0m A:

Lineage for d3g0ma_ (3g0m A:)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.224: SufE/NifU [82648] (1 superfamily)
   alpha(2)-beta(3)-alpha(3); 2 layers alpha/beta, 3-stranded antiparallel beta-sheet; order 123

4. Superfamily d.224.1: SufE/NifU [82649] (4 families)
   iron-sulfur cluster assembly proteins

5. Family d.224.1.1: SufE-like [82650] (3 proteins)
   Fe-S metabolism associated domain
   automatically mapped to Pfam PF02657

6. Protein automated matches [191012] (2 species)
   not a true protein

7. Species Salmonella typhimurium [TaxId:99287] [188778] (1 PDB entry)

8. Domain d3g0ma_: 3g0m A: [176239]
   automated match to d1mzgb_
   complexed with bme, edo, peg

Details for d3g0ma_

PDB Entry: 3g0m, 1.76 Å

PDB Description: Crystal structure of cysteine desulfuration protein SufE from Salmonella typhimurium LT2

PDB Compounds: (A:) Cysteine desulfuration protein sufE

SCOPe Domain Sequences for d3g0ma_:

Sequence; same for both SEQRES and ATOM records:

>d3g0ma_ d.224.1.1 (A:) automated matches {Salmonella typhimurium [TaxId: 99287]}
maalpdkekllrnftrcanweekylyiielgqrlaelnpqdrnpqntihgcqsqvwivmr
rnangiielqgdsdaaivkglmavvfilyhqmtaqdivhfdvrpwfekmalaqhltpsrs
qgleamirairakaatls

Timeline for d3g0ma_:

• d3g0ma_ first appeared in SCOPe 2.01
  
• d3g0ma_ appears in SCOPe 2.04
  
• d3g0ma_ appears in SCOPe 2.06
  
• d3g0ma_ appears in the current release, SCOPe 2.08