![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily) core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest |
![]() | Superfamily c.69.1: alpha/beta-Hydrolases [53474] (43 families) ![]() many members have left-handed crossover connection between strand 8 and additional strand 9 |
![]() | Family c.69.1.11: Epoxide hydrolase [53525] (3 proteins) |
![]() | Protein Bacterial epoxide hydrolase [53528] (2 species) |
![]() | Species Aspergillus niger [TaxId:5061] [53530] (3 PDB entries) |
![]() | Domain d3g0ib1: 3g0i B:5-396 [176238] Other proteins in same PDB: d3g0ia2, d3g0ib2 automated match to d1qo7a_ complexed with vpr |
PDB Entry: 3g0i (more details), 2.1 Å
SCOPe Domain Sequences for d3g0ib1:
Sequence, based on SEQRES records: (download)
>d3g0ib1 c.69.1.11 (B:5-396) Bacterial epoxide hydrolase {Aspergillus niger [TaxId: 5061]} fakfpssasispnpftvsipdeqlddlktlvrlskiapptyeslqadgrfgitsewlttm rekwlsefdwrpfearlnsfpqftteiegltihfaalfseredavpiallhgwpgsfvef ypilqlfreeytpetlpfhlvvpslpgytfssgppldkdfglmdnarvvdqlmkdlgfgs gyiiqggdigsfvgrllgvgfdackavhlnlcamrappegpsieslsaaekegiarmekf mtdglayamehstrpstighvlssspiallawigekylqwvdkplpsetilemvslywlt esfpraihtyrettptasapngatmlqkelyihkpfgfsffpkdlcpvprswiattgnlv ffrdhaegghfaalerprelktdltafveqvw
>d3g0ib1 c.69.1.11 (B:5-396) Bacterial epoxide hydrolase {Aspergillus niger [TaxId: 5061]} fakfpssasispnpftvsipdeqlddlktlvrlskiapptyeslqadgrfgitsewlttm rekwlsefdwrpfearlnsfpqftteiegltihfaalfseredavpiallhgwpgsfvef ypilqlfreeytpetlpfhlvvpslpgytfssgppldkdfglmdnarvvdqlmkdlgfgs gyiiqggdigsfvgrllgvgfdackavhlnlcamrappegpsieslsaaekegiarmekf mtdglayamehstrpstighvlssspiallawigekylqwvdkplpsetilemvslywlt esfpraihtyrettpmlqkelyihkpfgfsffpkdlcpvprswiattgnlvffrdhaegg hfaalerprelktdltafveqvw
Timeline for d3g0ib1: