Lineage for d3g0ea1 (3g0e A:544-931)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2218047Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 2218048Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 2218179Family d.144.1.7: Protein kinases, catalytic subunit [88854] (66 proteins)
    members organized in the groups and subfamiles specified by the comments
  6. 2218391Protein c-KIT receptor [103296] (1 species)
    PTK group; PDGFR/VEGFR subfamily; membrane spanning protein tyrosine kinase
  7. 2218392Species Human (Homo sapiens) [TaxId:9606] [103297] (5 PDB entries)
    Uniprot P10721 547-935
  8. 2218394Domain d3g0ea1: 3g0e A:544-931 [176234]
    Other proteins in same PDB: d3g0ea2
    automated match to d1t45a_
    complexed with b49

Details for d3g0ea1

PDB Entry: 3g0e (more details), 1.6 Å

PDB Description: kit kinase domain in complex with sunitinib
PDB Compounds: (A:) Mast/stem cell growth factor receptor

SCOPe Domain Sequences for d3g0ea1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3g0ea1 d.144.1.7 (A:544-931) c-KIT receptor {Human (Homo sapiens) [TaxId: 9606]}
tykylqkpmyevqwkvveeingnnyvyidptqlpydhkwefprnrlsfgktlgagafgkv
veataygliksdaamtvavkmlkpsahlterealmselkvlsylgnhmnivnllgactig
gptlviteyccygdllnflrrkrdsficsktspaimeddelaldledllsfsyqvakgma
flaskncihrdlaarnillthgritkicdfglardikndsnyvvkgnarlpvkwmapesi
fncvytfesdvwsygiflwelfslgsspypgmpvdskfykmikegfrmlspehapaemyd
imktcwdadplkrptfkqivqliekqises

SCOPe Domain Coordinates for d3g0ea1:

Click to download the PDB-style file with coordinates for d3g0ea1.
(The format of our PDB-style files is described here.)

Timeline for d3g0ea1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3g0ea2