SCOPe 2.08: Domain d3g0ea1: 3g0e A:544-931

Lineage for d3g0ea1 (3g0e A:544-931)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
   consists of two alpha+beta domains, C-terminal domain is mostly alpha helical

4. Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families)
   shares functional and structural similarities with the ATP-grasp fold and PIPK

5. Family d.144.1.7: Protein kinases, catalytic subunit [88854] (66 proteins)
   members organized in the groups and subfamiles specified by the comments

6. Protein c-KIT receptor [103296] (1 species)
   PTK group; PDGFR/VEGFR subfamily; membrane spanning protein tyrosine kinase

7. Species Human (Homo sapiens) [TaxId:9606] [103297] (18 PDB entries)
   Uniprot P10721 547-935

8. Domain d3g0ea1: 3g0e A:544-931 [176234]
   Other proteins in same PDB: d3g0ea2
   automated match to d1t45a_
   complexed with b49

Details for d3g0ea1

PDB Entry: 3g0e, 1.6 Å

PDB Description: kit kinase domain in complex with sunitinib

PDB Compounds: (A:) Mast/stem cell growth factor receptor

SCOPe Domain Sequences for d3g0ea1:

Sequence; same for both SEQRES and ATOM records:

>d3g0ea1 d.144.1.7 (A:544-931) c-KIT receptor {Human (Homo sapiens) [TaxId: 9606]}
tykylqkpmyevqwkvveeingnnyvyidptqlpydhkwefprnrlsfgktlgagafgkv
veataygliksdaamtvavkmlkpsahlterealmselkvlsylgnhmnivnllgactig
gptlviteyccygdllnflrrkrdsficsktspaimeddelaldledllsfsyqvakgma
flaskncihrdlaarnillthgritkicdfglardikndsnyvvkgnarlpvkwmapesi
fncvytfesdvwsygiflwelfslgsspypgmpvdskfykmikegfrmlspehapaemyd
imktcwdadplkrptfkqivqliekqises

Timeline for d3g0ea1:

• d3g0ea1 first appeared in SCOPe 2.01, called d3g0ea_
  
• d3g0ea1 appears in SCOPe 2.07