SCOPe 2.08: Domain d3g03a_: 3g03 A:

Lineage for d3g03a_ (3g03 A:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.42: SWIB/MDM2 domain [47591] (1 superfamily)
   core: 4 helices: open bundle; capped by two small 3-stranded beta-sheets
   duplication: consists of two structural repeats

4. Superfamily a.42.1: SWIB/MDM2 domain [47592] (2 families)
   binds to the transactivation domain of human p53

5. Family a.42.1.1: SWIB/MDM2 domain [47593] (5 proteins)
   Pfam PF02201

6. Protein MDM2 [47594] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [47596] (76 PDB entries)

8. Domain d3g03a_: 3g03 A: [176230]
   automated match to d1rv1a_

Details for d3g03a_

PDB Entry: 3g03, 1.8 Å

PDB Description: structure of human mdm2 in complex with high affinity peptide

PDB Compounds: (A:) E3 ubiquitin-protein ligase Mdm2

SCOPe Domain Sequences for d3g03a_:

Sequence; same for both SEQRES and ATOM records:

>d3g03a_ a.42.1.1 (A:) MDM2 {Human (Homo sapiens) [TaxId: 9606]}
etlvrpkplllkllksvgaqkdtytmkevlfylgqyimtkrlydekqqhivycsndllgd
lfgvpsfsvkehrkiytmiyrnlvvvn

Timeline for d3g03a_:

• d3g03a_ first appeared in SCOPe 2.01
  
• d3g03a_ appears in SCOPe 2.07