Lineage for d4gtuc1 (4gtu C:85-217)
- Root: SCOPe 2.07
Class a: All alpha proteins [46456] (289 folds) 
Fold a.45: GST C-terminal domain-like [47615] (1 superfamily)
core: 4 helices; bundle, closed, left-handed twist; right-handed superhelixSuperfamily a.45.1: GST C-terminal domain-like [47616] (3 families) 
this domains follows the thioredoxin-like N-terminal domain
Family a.45.1.1: Glutathione S-transferase (GST), C-terminal domain [47617] (19 proteins) 
Protein Class mu GST [81348] (3 species) Species Human (Homo sapiens) [TaxId:9606] [47622] (16 PDB entries)
Uniprot P09488 P28161
Domain d4gtuc1: 4gtu C:85-217 [17623]
Other proteins in same PDB: d4gtua2, d4gtub2, d4gtuc2, d4gtud2, d4gtue2, d4gtuf2, d4gtug2, d4gtuh2
Details for d4gtuc1
PDB Entry: 4gtu (more details), 3.3 Å
PDB Description: ligand-free homodimeric human glutathione s-transferase m4-4
PDB Compounds: (C:) glutathione s-transferaseSCOPe Domain Sequences for d4gtuc1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4gtuc1 a.45.1.1 (C:85-217) Class mu GST {Human (Homo sapiens) [TaxId: 9606]}
lcgeteeekirvdilenqamdvsnqlarvcyspdfeklkpeyleelptmmqhfsqflgkr
pwfvgdkitfvdflaydvldlhrifepncldafpnlkdfisrfeglekisaymkssrflp
kplytrvavwgnk
SCOPe Domain Coordinates for d4gtuc1:
Click to download the PDB-style file with coordinates for d4gtuc1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d4gtuc1:
View in 3D
