Lineage for d3g01b_ (3g01 B:)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2387558Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
    barrel, closed; n=6, S=8; greek-key
    duplication: consists of two domains of the same fold
  4. 2387559Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) (S)
  5. 2387819Family b.47.1.2: Eukaryotic proteases [50514] (49 proteins)
  6. 2389542Protein automated matches [190044] (14 species)
    not a true protein
  7. 2389751Species Mouse (Mus musculus) [TaxId:10090] [188816] (4 PDB entries)
  8. 2389757Domain d3g01b_: 3g01 B: [176227]
    automated match to d1fi8a_
    mutant

Details for d3g01b_

PDB Entry: 3g01 (more details), 2.5 Å

PDB Description: Structure of GrC mutant E192R/E193G
PDB Compounds: (B:) Granzyme C

SCOPe Domain Sequences for d3g01b_:

Sequence, based on SEQRES records: (download)

>d3g01b_ b.47.1.2 (B:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
iiggneisphsrpymayyeflkvggkkmfcggflvrdkfvltaahckgrsmtvtlgahni
kakeetqqiipvakaiphpdynpddrsndimllklvrnakrtravrplnlprrnahvkpg
decyvagwgkvtpdgefpktlhevkltvqkdqvcesqfqssynraneicvgdskikgasf
rgdsggplvckraaagivsygqtdgsapqvftrvlsfvswikktmkh

Sequence, based on observed residues (ATOM records): (download)

>d3g01b_ b.47.1.2 (B:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
iiggneisphsrpymayyeflkvggkkmfcggflvrdkfvltaahckgrsmtvtlgahni
kakeetqqiipvakaiphpdynpddrsndimllklvrnakrtravrplnlprrnahvkpg
decyvagwgkvktlhevkltvqkdqvcesqfqssynraneicvgdgdsggplvckraaag
ivsygqgsapqvftrvlsfvswikktmkh

SCOPe Domain Coordinates for d3g01b_:

Click to download the PDB-style file with coordinates for d3g01b_.
(The format of our PDB-style files is described here.)

Timeline for d3g01b_:

View in 3D
Domains from other chains:
(mouse over for more information)
d3g01a_