Class b: All beta proteins [48724] (174 folds) |
Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily) barrel, closed; n=6, S=8; greek-key duplication: consists of two domains of the same fold |
Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) |
Family b.47.1.2: Eukaryotic proteases [50514] (48 proteins) |
Protein automated matches [190044] (14 species) not a true protein |
Species Mouse (Mus musculus) [TaxId:10090] [188816] (2 PDB entries) |
Domain d3fzzb_: 3fzz B: [176225] automated match to d1fi8a_ complexed with so4 |
PDB Entry: 3fzz (more details), 2.5 Å
SCOPe Domain Sequences for d3fzzb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3fzzb_ b.47.1.2 (B:) automated matches {Mouse (Mus musculus) [TaxId: 10090]} iiggneisphsrpymayyeflkvggkkmfcggflvrdkfvltaahckgrsmtvtlgahni kakeetqqiipvakaiphpdynpddrsndimllklvrnakrtravrplnlprrnahvkpg decyvagwgkvtpdgefpktlhevkltvqkdqvcesqfqssynraneicvgdskikgasf eedsggplvckraaagivsygqtdgsapqvftrvlsfvswikktmkh
Timeline for d3fzzb_: