SCOPe 2.02: Domain d3fzzb_: 3fzz B:

Lineage for d3fzzb_ (3fzz B:)

1. Root: SCOPe 2.02

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
   barrel, closed; n=6, S=8; greek-key
   duplication: consists of two domains of the same fold

4. Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families)

5. Family b.47.1.2: Eukaryotic proteases [50514] (48 proteins)

6. Protein automated matches [190044] (13 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [188816] (2 PDB entries)

8. Domain d3fzzb_: 3fzz B: [176225]
   automated match to d1fi8a_
   complexed with so4

Details for d3fzzb_

PDB Entry: 3fzz, 2.5 Å

PDB Description: Structure of GrC

PDB Compounds: (B:) Granzyme C

SCOPe Domain Sequences for d3fzzb_:

Sequence; same for both SEQRES and ATOM records:

>d3fzzb_ b.47.1.2 (B:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
iiggneisphsrpymayyeflkvggkkmfcggflvrdkfvltaahckgrsmtvtlgahni
kakeetqqiipvakaiphpdynpddrsndimllklvrnakrtravrplnlprrnahvkpg
decyvagwgkvtpdgefpktlhevkltvqkdqvcesqfqssynraneicvgdskikgasf
eedsggplvckraaagivsygqtdgsapqvftrvlsfvswikktmkh

Timeline for d3fzzb_:

• d3fzzb_ first appeared in SCOPe 2.01
  
• d3fzzb_ appears in SCOPe 2.03
  
• d3fzzb_ appears in the current release, SCOPe 2.08