Lineage for d3fzza_ (3fzz A:)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2064170Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
    barrel, closed; n=6, S=8; greek-key
    duplication: consists of two domains of the same fold
  4. 2064171Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) (S)
  5. 2064431Family b.47.1.2: Eukaryotic proteases [50514] (49 proteins)
  6. 2066146Protein automated matches [190044] (14 species)
    not a true protein
  7. 2066364Species Mouse (Mus musculus) [TaxId:10090] [188816] (4 PDB entries)
  8. 2066371Domain d3fzza_: 3fzz A: [176224]
    automated match to d1fi8a_
    complexed with so4

Details for d3fzza_

PDB Entry: 3fzz (more details), 2.5 Å

PDB Description: Structure of GrC
PDB Compounds: (A:) Granzyme C

SCOPe Domain Sequences for d3fzza_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3fzza_ b.47.1.2 (A:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
iiggneisphsrpymayyeflkvggkkmfcggflvrdkfvltaahckgrsmtvtlgahni
kakeetqqiipvakaiphpdynpddrsndimllklvrnakrtravrplnlprrnahvkpg
decyvagwgkvtpdgefpktlhevkltvqkdqvcesqfqssynraneicvgdskikgasf
eedsggplvckraaagivsygqtdgsapqvftrvlsfvswikktmkh

SCOPe Domain Coordinates for d3fzza_:

Click to download the PDB-style file with coordinates for d3fzza_.
(The format of our PDB-style files is described here.)

Timeline for d3fzza_: