SCOP 1.75: Domain d4gtub1: 4gtu B:85-217

Lineage for d4gtub1 (4gtu B:85-217)

1. Root: SCOP 1.75

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.45: GST C-terminal domain-like [47615] (1 superfamily)
   core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix

4. Superfamily a.45.1: GST C-terminal domain-like [47616] (2 families)
   this domains follows the thioredoxin-like N-terminal domain

5. Family a.45.1.1: Glutathione S-transferase (GST), C-terminal domain [47617] (18 proteins)

6. Protein Class mu GST [81348] (3 species)

7. Species Human (Homo sapiens) [TaxId:9606] [47622] (15 PDB entries)
   Uniprot P09488 P28161

8. Domain d4gtub1: 4gtu B:85-217 [17622]
   Other proteins in same PDB: d4gtua2, d4gtub2, d4gtuc2, d4gtud2, d4gtue2, d4gtuf2, d4gtug2, d4gtuh2

Details for d4gtub1

PDB Entry: 4gtu, 3.3 Å

PDB Description: ligand-free homodimeric human glutathione s-transferase m4-4

PDB Compounds: (B:) glutathione s-transferase

SCOP Domain Sequences for d4gtub1:

Sequence; same for both SEQRES and ATOM records:

>d4gtub1 a.45.1.1 (B:85-217) Class mu GST {Human (Homo sapiens) [TaxId: 9606]}
lcgeteeekirvdilenqamdvsnqlarvcyspdfeklkpeyleelptmmqhfsqflgkr
pwfvgdkitfvdflaydvldlhrifepncldafpnlkdfisrfeglekisaymkssrflp
kplytrvavwgnk

Timeline for d4gtub1:

• d4gtub1 first appeared (with stable ids) in SCOP 1.55
  
• d4gtub1 appears in SCOP 1.73
  
• d4gtub1 appears in SCOPe 2.01
  
• d4gtub1 appears in the current release, SCOPe 2.08