Lineage for d4gtub1 (4gtu B:85-217)

  1. Root: SCOP 1.59
  2. 93448Class a: All alpha proteins [46456] (151 folds)
  3. 97949Fold a.45: Glutathione S-transferases, C-terminal domain [47615] (1 superfamily)
  4. 97950Superfamily a.45.1: Glutathione S-transferases, C-terminal domain [47616] (1 family) (S)
  5. 97951Family a.45.1.1: Glutathione S-transferases, C-terminal domain [47617] (4 proteins)
  6. 97963Protein Glutathione S-transferase [47618] (24 species)
  7. 98006Species Human (Homo sapiens), class mu [TaxId:9606] [47622] (7 PDB entries)
  8. 98025Domain d4gtub1: 4gtu B:85-217 [17622]
    Other proteins in same PDB: d4gtua2, d4gtub2, d4gtuc2, d4gtud2, d4gtue2, d4gtuf2, d4gtug2, d4gtuh2

Details for d4gtub1

PDB Entry: 4gtu (more details), 3.3 Å

PDB Description: ligand-free homodimeric human glutathione s-transferase m4-4

SCOP Domain Sequences for d4gtub1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4gtub1 a.45.1.1 (B:85-217) Glutathione S-transferase {Human (Homo sapiens), class mu}
lcgeteeekirvdilenqamdvsnqlarvcyspdfeklkpeyleelptmmqhfsqflgkr
pwfvgdkitfvdflaydvldlhrifepncldafpnlkdfisrfeglekisaymkssrflp
kplytrvavwgnk

SCOP Domain Coordinates for d4gtub1:

Click to download the PDB-style file with coordinates for d4gtub1.
(The format of our PDB-style files is described here.)

Timeline for d4gtub1: