SCOPe 2.07: Domain d3fzqa_: 3fzq A:

Lineage for d3fzqa_ (3fzq A:)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.108: HAD-like [56783] (1 superfamily)
   3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456

4. Superfamily c.108.1: HAD-like [56784] (26 families)
   usually contains an insertion (sub)domain after strand 1

5. Family c.108.1.0: automated matches [191369] (1 protein)
   not a true family

6. Protein automated matches [190447] (55 species)
   not a true protein

7. Species Clostridium difficile [TaxId:272563] [188776] (3 PDB entries)

8. Domain d3fzqa_: 3fzq A: [176217]
   automated match to d1nf2a_
   complexed with edo, na, po4

Details for d3fzqa_

PDB Entry: 3fzq, 2.1 Å

PDB Description: crystal structure of putative haloacid dehalogenase-like hydrolase (yp_001086940.1) from clostridium difficile 630 at 2.10 a resolution

PDB Compounds: (A:) Putative hydrolase

SCOPe Domain Sequences for d3fzqa_:

Sequence; same for both SEQRES and ATOM records:

>d3fzqa_ c.108.1.0 (A:) automated matches {Clostridium difficile [TaxId: 272563]}
lykllildidgtlrdevygipesakhairlcqknhcsvvictgrsmgtiqddvlslgvdg
yiagggnyiqyhgellynqsfnqrlikevvcllkkrevafsiesqekvfmnqkakeifet
mnqlkgtnscinkqhiqekityennieeyksqdihkiclwsnekvfdevkdilqdkmela
qrdissqyyeiiqkdfhkgkaikrlqerlgvtqketicfgdgqndivmfqasdvtiamkn
shqqlkdiatsicedifdngiykelkrrnii

Timeline for d3fzqa_:

• d3fzqa_ first appeared in SCOPe 2.01
  
• d3fzqa_ appears in SCOPe 2.06
  
• d3fzqa_ appears in the current release, SCOPe 2.08