Lineage for d3fzqa_ (3fzq A:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2526731Fold c.108: HAD-like [56783] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456
  4. 2526732Superfamily c.108.1: HAD-like [56784] (26 families) (S)
    usually contains an insertion (sub)domain after strand 1
  5. 2527523Family c.108.1.0: automated matches [191369] (1 protein)
    not a true family
  6. 2527524Protein automated matches [190447] (55 species)
    not a true protein
  7. 2527637Species Clostridium difficile [TaxId:272563] [188776] (3 PDB entries)
  8. 2527639Domain d3fzqa_: 3fzq A: [176217]
    automated match to d1nf2a_
    complexed with edo, na, po4

Details for d3fzqa_

PDB Entry: 3fzq (more details), 2.1 Å

PDB Description: crystal structure of putative haloacid dehalogenase-like hydrolase (yp_001086940.1) from clostridium difficile 630 at 2.10 a resolution
PDB Compounds: (A:) Putative hydrolase

SCOPe Domain Sequences for d3fzqa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3fzqa_ c.108.1.0 (A:) automated matches {Clostridium difficile [TaxId: 272563]}
lykllildidgtlrdevygipesakhairlcqknhcsvvictgrsmgtiqddvlslgvdg
yiagggnyiqyhgellynqsfnqrlikevvcllkkrevafsiesqekvfmnqkakeifet
mnqlkgtnscinkqhiqekityennieeyksqdihkiclwsnekvfdevkdilqdkmela
qrdissqyyeiiqkdfhkgkaikrlqerlgvtqketicfgdgqndivmfqasdvtiamkn
shqqlkdiatsicedifdngiykelkrrnii

SCOPe Domain Coordinates for d3fzqa_:

Click to download the PDB-style file with coordinates for d3fzqa_.
(The format of our PDB-style files is described here.)

Timeline for d3fzqa_: