SCOPe 2.08: Domain d3fzbf1: 3fzb F:4-134

Lineage for d3fzbf1 (3fzb F:4-134)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.323: Phage tail protein-like [143748] (1 superfamily)
   alpha-beta-X-beta(2)-alpha-beta(2); 2 layers: a/b; mixed beta-sheet: order 12354, strands 1 and 2 are parallel

4. Superfamily d.323.1: Phage tail protein-like [143749] (2 families)
   Can form ring, tube-like oligomers, where the subunit beta-sheets are joined in a single beta-sheet (or barrel)

5. Family d.323.1.1: Lambda phage gpU-like [143750] (2 proteins)
   Pfam PF06141

6. Protein automated matches [191050] (1 species)
   not a true protein

7. Species Enterobacteria phage [TaxId:10710] [188903] (2 PDB entries)

8. Domain d3fzbf1: 3fzb F:4-134 [176204]
   Other proteins in same PDB: d3fzba2, d3fzbb2, d3fzbc2, d3fzbd2, d3fzbf2, d3fzbg2, d3fzbj2
   automated match to d1z1za1
   complexed with so4

Details for d3fzbf1

PDB Entry: 3fzb, 2.8 Å

PDB Description: crystal structure of the tail terminator protein from phage lambda (gpu-wt)

PDB Compounds: (F:) Minor tail protein U

SCOPe Domain Sequences for d3fzbf1:

Sequence, based on SEQRES records:

>d3fzbf1 d.323.1.1 (F:4-134) automated matches {Enterobacteria phage [TaxId: 10710]}
mkhtelraavldalekhdtgatffdgrpavfdeadfpavavyltgaeytgeeldsdtwqa
elhievflpaqvpdseldawmesriypvmsdipalsdlitsmvasgydyrrdddaglwss
adltyvityem

Sequence, based on observed residues (ATOM records):

>d3fzbf1 d.323.1.1 (F:4-134) automated matches {Enterobacteria phage [TaxId: 10710]}
mkhtelraavldalekhgatffdgrpavfdeadfpavavyltgaeytgeeldsdtwqael
hievflpaqvpdseldawmesriypvmsdipalsdlitsmvasgydyrrdddaglwssad
ltyvityem

Timeline for d3fzbf1:

• d3fzbf1 first appeared in SCOPe 2.01, called d3fzbf_
  
• d3fzbf1 appears in SCOPe 2.07