Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
Fold d.323: Phage tail protein-like [143748] (1 superfamily) alpha-beta-X-beta(2)-alpha-beta(2); 2 layers: a/b; mixed beta-sheet: order 12354, strands 1 and 2 are parallel |
Superfamily d.323.1: Phage tail protein-like [143749] (2 families) Can form ring, tube-like oligomers, where the subunit beta-sheets are joined in a single beta-sheet (or barrel) |
Family d.323.1.1: Lambda phage gpU-like [143750] (2 proteins) Pfam PF06141 |
Protein automated matches [191050] (1 species) not a true protein |
Species Enterobacteria phage [TaxId:10710] [188903] (2 PDB entries) |
Domain d3fzbe_: 3fzb E: [176203] Other proteins in same PDB: d3fzba2, d3fzbb2, d3fzbc2, d3fzbd2, d3fzbf2, d3fzbg2, d3fzbj2 automated match to d1z1za1 complexed with so4 |
PDB Entry: 3fzb (more details), 2.8 Å
SCOPe Domain Sequences for d3fzbe_:
Sequence, based on SEQRES records: (download)
>d3fzbe_ d.323.1.1 (E:) automated matches {Enterobacteria phage [TaxId: 10710]} mkhtelraavldalekhdtgatffdgrpavfdeadfpavavyltgaeytgeeldsdtwqa elhievflpaqvpdseldawmesriypvmsdipalsdlitsmvasgydyrrdddaglwss adltyvityem
>d3fzbe_ d.323.1.1 (E:) automated matches {Enterobacteria phage [TaxId: 10710]} mkhtelraavldalekhdgatffdgrpavfdeadfpavavyltgaeytgedsdtwqaelh ievflpaqvpdseldawmesriypvmsdipalsdlitsmvasgydyrrdddaglwssadl tyvityem
Timeline for d3fzbe_: