Lineage for d3fzaa_ (3fza A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2876126Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 2876127Superfamily c.47.1: Thioredoxin-like [52833] (24 families) (S)
  5. 2878967Family c.47.1.0: automated matches [191312] (1 protein)
    not a true family
  6. 2878968Protein automated matches [190056] (195 species)
    not a true protein
  7. 2880169Species Populus tremula [TaxId:47664] [188794] (10 PDB entries)
  8. 2880173Domain d3fzaa_: 3fza A: [176198]
    automated match to d1ktea_
    complexed with bme, gsh

Details for d3fzaa_

PDB Entry: 3fza (more details), 1.8 Å

PDB Description: Crystal structure of poplar glutaredoxin S12 in complex with glutathione and beta-mercaptoethanol
PDB Compounds: (A:) glutaredoxin

SCOPe Domain Sequences for d3fzaa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3fzaa_ c.47.1.0 (A:) automated matches {Populus tremula [TaxId: 47664]}
gsrledavkktvaenpvvvysktwcsyssevkslfkrlnvdplvveldelgaqgpqiqkv
lerltgqhtvpnvfiggkhiggctdtvklyrkgelepllseanakk

SCOPe Domain Coordinates for d3fzaa_:

Click to download the PDB-style file with coordinates for d3fzaa_.
(The format of our PDB-style files is described here.)

Timeline for d3fzaa_: