Lineage for d3fz7d_ (3fz7 D:)

  1. Root: SCOPe 2.02
  2. 1143363Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1176924Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies)
    main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest
  4. 1176925Superfamily c.67.1: PLP-dependent transferases [53383] (10 families) (S)
  5. 1177915Family c.67.1.6: Pyridoxal-dependent decarboxylase [69565] (4 proteins)
  6. 1177926Protein Glutamate decarboxylase beta, GadB [102596] (2 species)
  7. 1177927Species Escherichia coli K-12 [TaxId:83333] [188775] (2 PDB entries)
  8. 1177931Domain d3fz7d_: 3fz7 D: [176194]
    automated match to d1pmob_
    complexed with po4

Details for d3fz7d_

PDB Entry: 3fz7 (more details), 2.5 Å

PDB Description: crystal structure of apo glutamate decarboxylase beta from escherichia coli
PDB Compounds: (D:) Glutamate decarboxylase beta

SCOPe Domain Sequences for d3fz7d_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3fz7d_ c.67.1.6 (D:) Glutamate decarboxylase beta, GadB {Escherichia coli K-12 [TaxId: 83333]}
lldsrfgaksistiaeskrfplhemrddvafqiindelyldgnarqnlatfcqtwddenv
hklmdlsinknwidkeeypqsaaidlrcvnmvadlwhapapkngqavgtntigsseacml
ggmamkwrwrkrmeaagkptdkpnlvcgpvqicwhkfarywdvelreipmrpgqlfmdpk
rmieacdentigvvptfgvtytgnyefpqplhdaldkfqadtgididmhidaasggflap
fvapdivwdfrlprvksisasghkfglaplgcgwviwrdeealpqelvfnvdylggqigt
fainfsrpagqviaqyyeflrlgregytkvqnasyqvaayladeiaklgpyefictgrpd
egipavcfklkdgedpgytlydlserlrlrgwqvpaftlggeatdivvmrimcrrgfemd
faellledykaslkylsdhpklqgiaqqnsfkht

SCOPe Domain Coordinates for d3fz7d_:

Click to download the PDB-style file with coordinates for d3fz7d_.
(The format of our PDB-style files is described here.)

Timeline for d3fz7d_: