Lineage for d1hnba1 (1hnb A:85-217)

  1. Root: SCOPe 2.03
  2. 1253684Class a: All alpha proteins [46456] (284 folds)
  3. 1270513Fold a.45: GST C-terminal domain-like [47615] (1 superfamily)
    core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix
  4. 1270514Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families) (S)
    this domains follows the thioredoxin-like N-terminal domain
  5. 1270515Family a.45.1.1: Glutathione S-transferase (GST), C-terminal domain [47617] (19 proteins)
  6. 1270721Protein Class mu GST [81348] (3 species)
  7. 1270729Species Human (Homo sapiens) [TaxId:9606] [47622] (16 PDB entries)
    Uniprot P09488 P28161
  8. 1270777Domain d1hnba1: 1hnb A:85-217 [17619]
    Other proteins in same PDB: d1hnba2, d1hnbb2
    complexed with gdn

Details for d1hnba1

PDB Entry: 1hnb (more details), 3.5 Å

PDB Description: crystal structure of human class mu glutathione transferase gstm2-2: effects of lattice packing on conformational heterogeneity
PDB Compounds: (A:) glutathione s-transferase

SCOPe Domain Sequences for d1hnba1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hnba1 a.45.1.1 (A:85-217) Class mu GST {Human (Homo sapiens) [TaxId: 9606]}
lcgesekeqiredilenqfmdsrmqlaklcydpdfeklkpeylqalpemlklysqflgkq
pwflgdkitfvdfiaydvlernqvfepscldafpnlkdfisrfeglekisaymkssrflp
rpvftkmavfgnk

SCOPe Domain Coordinates for d1hnba1:

Click to download the PDB-style file with coordinates for d1hnba1.
(The format of our PDB-style files is described here.)

Timeline for d1hnba1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1hnba2