Lineage for d3fz6e_ (3fz6 E:)

  1. Root: SCOPe 2.03
  2. 1336837Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1379866Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies)
    main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest
  4. 1379867Superfamily c.67.1: PLP-dependent transferases [53383] (10 families) (S)
  5. 1380885Family c.67.1.6: Pyridoxal-dependent decarboxylase [69565] (4 proteins)
    automatically mapped to Pfam PF00282
  6. 1380896Protein Glutamate decarboxylase beta, GadB [102596] (2 species)
  7. 1380897Species Escherichia coli K-12 [TaxId:83333] [188775] (2 PDB entries)
  8. 1380908Domain d3fz6e_: 3fz6 E: [176189]
    automated match to d1pmob_
    complexed with pmp, xe

Details for d3fz6e_

PDB Entry: 3fz6 (more details), 2.82 Å

PDB Description: Crystal structure of glutamate decarboxylase beta from Escherichia coli: complex with xenon
PDB Compounds: (E:) Glutamate decarboxylase beta

SCOPe Domain Sequences for d3fz6e_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3fz6e_ c.67.1.6 (E:) Glutamate decarboxylase beta, GadB {Escherichia coli K-12 [TaxId: 83333]}
kkqvtdlrselldsrfgaksistiaeskrfplhemrddvafqiindelyldgnarqnlat
fcqtwddenvhklmdlsinknwidkeeypqsaaidlrcvnmvadlwhapapkngqavgtn
tigsseacmlggmamkwrwrkrmeaagkptdkpnlvcgpvqicwhkfarywdvelreipm
rpgqlfmdpkrmieacdentigvvptfgvtytgnyefpqplhdaldkfqadtgididmhi
daasggflapfvapdivwdfrlprvksisasghkfglaplgcgwviwrdeealpqelvfn
vdylggqigtfainfsrpagqviaqyyeflrlgregytkvqnasyqvaayladeiaklgp
yefictgrpdegipavcfklkdgedpgytlydlserlrlrgwqvpaftlggeatdivvmr
imcrrgfemdfaellledykaslkylsdhpklqgiaqqnsfkht

SCOPe Domain Coordinates for d3fz6e_:

Click to download the PDB-style file with coordinates for d3fz6e_.
(The format of our PDB-style files is described here.)

Timeline for d3fz6e_: