Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.323: Phage tail protein-like [143748] (1 superfamily) alpha-beta-X-beta(2)-alpha-beta(2); 2 layers: a/b; mixed beta-sheet: order 12354, strands 1 and 2 are parallel |
Superfamily d.323.1: Phage tail protein-like [143749] (2 families) Can form ring, tube-like oligomers, where the subunit beta-sheets are joined in a single beta-sheet (or barrel) |
Family d.323.1.1: Lambda phage gpU-like [143750] (2 proteins) Pfam PF06141 |
Protein automated matches [191050] (1 species) not a true protein |
Species Enterobacteria phage [TaxId:10710] [188903] (2 PDB entries) |
Domain d3fz2h1: 3fz2 H:4-134 [176179] Other proteins in same PDB: d3fz2a2, d3fz2b2, d3fz2d2, d3fz2e2, d3fz2f2, d3fz2g2, d3fz2h2, d3fz2j2, d3fz2k2, d3fz2l2 automated match to d1z1za1 complexed with so4 |
PDB Entry: 3fz2 (more details), 2.7 Å
SCOPe Domain Sequences for d3fz2h1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3fz2h1 d.323.1.1 (H:4-134) automated matches {Enterobacteria phage [TaxId: 10710]} mkhtelraavldalekhdtgatffdgrpavfdeadfpavavyltgaeytgeeldsdtwqa elhievflpaqvpaseldawmesriypvmsdipalsdlitsmvasgydyrrdddaglwss adltyvityem
Timeline for d3fz2h1: