Lineage for d3fyub_ (3fyu B:)

  1. Root: SCOPe 2.01
  2. 968085Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1002544Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest
  4. 1002545Superfamily c.69.1: alpha/beta-Hydrolases [53474] (42 families) (S)
    many members have left-handed crossover connection between strand 8 and additional strand 9
  5. 1003800Family c.69.1.25: Acetyl xylan esterase-like [82504] (3 proteins)
    Pfam PF05448; AXE1
  6. 1003829Protein automated matches [191114] (2 species)
    not a true protein
  7. 1003830Species Bacillus pumilus [TaxId:1408] [189177] (5 PDB entries)
  8. 1003856Domain d3fyub_: 3fyu B: [176166]
    automated match to d1odtc_
    complexed with acy, cl, edo, xyp

Details for d3fyub_

PDB Entry: 3fyu (more details), 2.62 Å

PDB Description: crystal structure of acetyl xylan esterase from bacillus pumilus obtained in presence of d-xylose and sodium acetate
PDB Compounds: (B:) acetyl xylan esterase

SCOPe Domain Sequences for d3fyub_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3fyub_ c.69.1.25 (B:) automated matches {Bacillus pumilus [TaxId: 1408]}
mqlfdlsleelkkykpkktarpdfsdfwkksleelrqveaeptlesydypvkgvkvyrlt
yqsfghskiegfyavpdqtgphpalvrfhgynasydggihdivnwalhgyatfgmlvrgq
ggsedtsvtpgghalgwmtkgilskdtyyyrgvyldavraleviqsfpevdehrigvigg
xqggalaiaaaalsdipkvvvadypylsnferavdvaleqpyleinsyfrrnsdpkveek
afetlsyfdlinlagwvkqptlmaiglidkitppstvfaaynhletdkdlkvyryfghef
ipafqteklsflqkhlll

SCOPe Domain Coordinates for d3fyub_:

Click to download the PDB-style file with coordinates for d3fyub_.
(The format of our PDB-style files is described here.)

Timeline for d3fyub_: