Lineage for d3fytg_ (3fyt G:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1869037Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest
  4. 1869038Superfamily c.69.1: alpha/beta-Hydrolases [53474] (42 families) (S)
    many members have left-handed crossover connection between strand 8 and additional strand 9
  5. 1870685Family c.69.1.25: Acetyl xylan esterase-like [82504] (3 proteins)
    Pfam PF05448; AXE1
  6. 1870714Protein automated matches [191114] (2 species)
    not a true protein
  7. 1870715Species Bacillus pumilus [TaxId:1408] [189177] (6 PDB entries)
  8. 1870758Domain d3fytg_: 3fyt G: [176160]
    automated match to d1odtc_
    complexed with cl, xyp; mutant

Details for d3fytg_

PDB Entry: 3fyt (more details), 2.58 Å

PDB Description: crystal structure of bacillus pumilus acetyl xylan esterase s181a mutant in complex with beta-d-xylopyranose
PDB Compounds: (G:) acetyl xylan esterase

SCOPe Domain Sequences for d3fytg_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3fytg_ c.69.1.25 (G:) automated matches {Bacillus pumilus [TaxId: 1408]}
lsleelkkykpkktarpdfsdfwkksleelrqveaeptlesydypvkgvkvyrltyqsfg
hskiegfyavpdqtgphpalvrfhgynasydggihdivnwalhgyatfgmlvrgqggsed
tsvtpgghalgwmtkgilskdtyyyrgvyldavraleviqsfpevdehrigviggaqgga
laiaaaalsdipkvvvadypylsnferavdvaleqpyleinsyfrrnsdpkveekafetl
syfdlinlagwvkqptlmaiglidkitppstvfaaynhletdkdlkvyryfghefipafq
teklsflqkhll

SCOPe Domain Coordinates for d3fytg_:

Click to download the PDB-style file with coordinates for d3fytg_.
(The format of our PDB-style files is described here.)

Timeline for d3fytg_: