Lineage for d1hncb1 (1hnc B:85-217)
- Root: SCOPe 2.07
Class a: All alpha proteins [46456] (289 folds) 
Fold a.45: GST C-terminal domain-like [47615] (1 superfamily)
core: 4 helices; bundle, closed, left-handed twist; right-handed superhelixSuperfamily a.45.1: GST C-terminal domain-like [47616] (3 families) 
this domains follows the thioredoxin-like N-terminal domain
Family a.45.1.1: Glutathione S-transferase (GST), C-terminal domain [47617] (19 proteins) 
Protein Class mu GST [81348] (3 species) Species Human (Homo sapiens) [TaxId:9606] [47622] (16 PDB entries)
Uniprot P09488 P28161
Domain d1hncb1: 1hnc B:85-217 [17616]
Other proteins in same PDB: d1hnca2, d1hncb2, d1hncc2, d1hncd2
complexed with gdn
Details for d1hncb1
PDB Entry: 1hnc (more details), 3 Å
PDB Description: crystal structure of human class mu glutathione transferase gstm2-2: effects of lattice packing on conformational heterogeneity
PDB Compounds: (B:) glutathione s-transferaseSCOPe Domain Sequences for d1hncb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1hncb1 a.45.1.1 (B:85-217) Class mu GST {Human (Homo sapiens) [TaxId: 9606]}
lcgesekeqiredilenqfmdsrmqlaklcydpdfeklkpeylqalpemlklysqflgkq
pwflgdkitfvdfiaydvlernqvfepscldafpnlkdfisrfeglekisaymkssrflp
rpvftkmavfgnk
SCOPe Domain Coordinates for d1hncb1:
Click to download the PDB-style file with coordinates for d1hncb1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1hncb1:
View in 3D
