Lineage for d3fyob_ (3fyo B:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2078560Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2085156Superfamily c.1.10: Aldolase [51569] (9 families) (S)
    Common fold covers whole protein structure
  5. 2086072Family c.1.10.4: Class I DAHP synthetase [51599] (3 protein domains)
  6. 2086269Protein automated matches [190083] (8 species)
    not a true protein
  7. 2086351Species Neisseria meningitidis [TaxId:491] [188836] (2 PDB entries)
  8. 2086357Domain d3fyob_: 3fyo B: [176144]
    automated match to d1d9ea_
    complexed with cl, mn, na, pep; mutant

Details for d3fyob_

PDB Entry: 3fyo (more details), 1.9 Å

PDB Description: Crystal structure of the triple mutant (N23C/D247E/P249A) of 3-deoxy-D-manno-octulosonate 8-phosphate synthase (KDO8PS) from Neisseria meningitidis
PDB Compounds: (B:) 3-deoxy-D-manno-octulosonic acid 8-phosphate synthetase

SCOPe Domain Sequences for d3fyob_:

Sequence, based on SEQRES records: (download)

>d3fyob_ c.1.10.4 (B:) automated matches {Neisseria meningitidis [TaxId: 491]}
mdikinditlgnnspfvlfggicvlesldstlqtcahyvevtrklgipyifkasfdkanr
ssihsyrgvgleeglkifekvkaefgipvitdvhephqcqpvaevcdviqlpaflarqtd
lvvamaktgnvvnikkpqflspsqmknivekfheagngklilcergssfgydnlvvdmlg
fgvmkqtcgnlpvifdvthslqtrdagsaasggrraqaldlalagmatrlaglfleshpd
pklakcegasalplhlledflirikalddliksqpilti

Sequence, based on observed residues (ATOM records): (download)

>d3fyob_ c.1.10.4 (B:) automated matches {Neisseria meningitidis [TaxId: 491]}
mdikinditlgnnspfvlfggicvlesldstlqtcahyvevtrklgipyifkasfdkanr
ssihsyrgvgleeglkifekvkaefgipvitdvhephqcqpvaevcdviqlpaflarqtd
lvvamaktgnvvnikkpqflspsqmknivekfheagngklilcergssfgydnlvvdmlg
fgvmkqtcgnlpvifdvthslqgrraqaldlalagmatrlaglfleshpegasalplhll
edflirikalddliksqpilti

SCOPe Domain Coordinates for d3fyob_:

Click to download the PDB-style file with coordinates for d3fyob_.
(The format of our PDB-style files is described here.)

Timeline for d3fyob_: