Lineage for d3gtud1 (3gtu D:85-224)

  1. Root: SCOP 1.71
  2. 530466Class a: All alpha proteins [46456] (226 folds)
  3. 538429Fold a.45: Glutathione S-transferase (GST), C-terminal domain [47615] (1 superfamily)
    core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix
  4. 538430Superfamily a.45.1: Glutathione S-transferase (GST), C-terminal domain [47616] (1 family) (S)
    this domains follows the thioredoxin-like N-terminal domain
  5. 538431Family a.45.1.1: Glutathione S-transferase (GST), C-terminal domain [47617] (16 proteins)
  6. 538565Protein Class mu GST [81348] (3 species)
  7. 538573Species Human (Homo sapiens) [TaxId:9606] [47622] (10 PDB entries)
  8. 538593Domain d3gtud1: 3gtu D:85-224 [17614]
    Other proteins in same PDB: d3gtua2, d3gtub2, d3gtuc2, d3gtud2

Details for d3gtud1

PDB Entry: 3gtu (more details), 2.8 Å

PDB Description: ligand-free heterodimeric human glutathione s-transferase m2-3 (ec 2.5.1.18), monoclinic crystal form

SCOP Domain Sequences for d3gtud1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3gtud1 a.45.1.1 (D:85-224) Class mu GST {Human (Homo sapiens)}
rkhnmcgeteeekirvdiienqvmdfrtqlirlcyssdheklkpqyleelpgqlkqfsmf
lgkfswfagekltfvdfltydildqnrifdpkcldefpnlkafmcrfealekiaaylqsd
qfckmpinnkmaqwgnkpvc

SCOP Domain Coordinates for d3gtud1:

Click to download the PDB-style file with coordinates for d3gtud1.
(The format of our PDB-style files is described here.)

Timeline for d3gtud1: