Lineage for d3fyec_ (3fye C:)

  1. Root: SCOPe 2.07
  2. 2626587Class f: Membrane and cell surface proteins and peptides [56835] (60 folds)
  3. 2632295Fold f.24: Cytochrome c oxidase subunit I-like [81443] (1 superfamily)
    12 transmembrane helices in an approximate threefold rotational symmetric arrangement
  4. 2632296Superfamily f.24.1: Cytochrome c oxidase subunit I-like [81442] (1 family) (S)
  5. 2632297Family f.24.1.1: Cytochrome c oxidase subunit I-like [81441] (5 proteins)
    the largest and best conserved subunit, contains two heme groups, low spin heme a and high spin heme a3
  6. 2632298Protein Bacterial aa3 type cytochrome c oxidase subunit I [81436] (2 species)
  7. 2632302Species Rhodobacter sphaeroides [TaxId:1063] [81435] (6 PDB entries)
  8. 2632310Domain d3fyec_: 3fye C: [176138]
    Other proteins in same PDB: d3fyeb1, d3fyeb2, d3fyeb3, d3fyed1, d3fyed2, d3fyed3
    automated match to d1m56a_
    complexed with ca, cd, cu1, dmu, hea, hto, mg, trd, unx

Details for d3fyec_

PDB Entry: 3fye (more details), 2.15 Å

PDB Description: catalytic core subunits (i and ii) of cytochrome c oxidase from rhodobacter sphaeroides in the reduced state
PDB Compounds: (C:) Cytochrome c oxidase subunit 1

SCOPe Domain Sequences for d3fyec_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3fyec_ f.24.1.1 (C:) Bacterial aa3 type cytochrome c oxidase subunit I {Rhodobacter sphaeroides [TaxId: 1063]}
wfmstnhkdigvlylftgglvglisvaftvymrmelmapgvqfmcaehlesglvkgffqs
lwpsavenctpnghlwnvmitghgilmmffvvipalfggfgnyfmplhigapdmafprmn
nlsywlyvagtslavaslfapggngqlgsgigwvlypplstsesgystdlaifavhlsga
ssilgainmittflnmrapgmtmhkvplfawsifvtawlillalpvlagaitmlltdrnf
gttffqpsgggdpvlyqhilwffghpevyiivlpafgivshviatfakkpifgylpmvya
mvaigvlgfvvwahhmytaglsltqqsyfmmatmviavptgikifswiatmwggsielkt
pmlwalgflflftvggvtgivlsqasvdryyhdtyyvvahfhyvmslgavfgifagiyfw
igkmsgrqypewagklhfwmmfvganltffpqhflgrqgmprryidypeafatwnfvssl
gaflsfasflfflgvifytltrgarvtannywnehadtlewtltspppeht

SCOPe Domain Coordinates for d3fyec_:

Click to download the PDB-style file with coordinates for d3fyec_.
(The format of our PDB-style files is described here.)

Timeline for d3fyec_: