SCOPe 2.01: Domain d3fy5a_: 3fy5 A:

Lineage for d3fy5a_ (3fy5 A:)

1. Root: SCOPe 2.01

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.36: PDZ domain-like [50155] (1 superfamily)
   contains barrel, partly opened; n*=4, S*=8; meander; capped by alpha-helix

4. Superfamily b.36.1: PDZ domain-like [50156] (7 families)
   peptide-binding domain

5. Family b.36.1.1: PDZ domain [50157] (47 proteins)
   Pfam PF00595

6. Protein automated matches [190055] (4 species)
   not a true protein

7. Species African clawed frog (Xenopus laevis) [TaxId:8355] [187076] (1 PDB entry)

8. Domain d3fy5a_: 3fy5 A: [176133]
   automated match to d1l6oa_

Details for d3fy5a_

PDB Entry: 3fy5, 2.4 Å

PDB Description: Dishevelled PDZ domain homodimer

PDB Compounds: (A:) Segment polarity protein dishevelled homolog DVL-2

SCOPe Domain Sequences for d3fy5a_:

Sequence; same for both SEQRES and ATOM records:

>d3fy5a_ b.36.1.1 (A:) automated matches {African clawed frog (Xenopus laevis) [TaxId: 8355]}
mtvtlnmekynflgisivgqsnergdggiyigsimkggavaadgriepgdmllqvndinf
enmsnddavrvlrdivhkpgpivltvakcwd

Timeline for d3fy5a_:

• d3fy5a_ is new in SCOPe 2.01-stable
  
• d3fy5a_ appears in SCOPe 2.02
  
• d3fy5a_ appears in the current release, SCOPe 2.08