Lineage for d3fx7b1 (3fx7 B:5-86)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2700837Fold a.25: Ferritin-like [47239] (6 superfamilies)
    core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection
  4. 2705424Superfamily a.25.5: HP0062-like [158414] (1 family) (S)
    (homo)dimer of alpha-hairpin subunits similar to that of the half-ferritin family; no bound metals
  5. 2705425Family a.25.5.1: HP0062-like [158415] (2 proteins)
    Pfam PF09647
  6. 2705429Protein automated matches [191069] (1 species)
    not a true protein
  7. 2705430Species Helicobacter pylori [TaxId:210] [188975] (1 PDB entry)
  8. 2705432Domain d3fx7b1: 3fx7 B:5-86 [176129]
    Other proteins in same PDB: d3fx7a2, d3fx7b2
    automated match to d2gtsa1

Details for d3fx7b1

PDB Entry: 3fx7 (more details), 1.65 Å

PDB Description: Crystal structure of hypothetical protein of HP0062 from Helicobacter pylori
PDB Compounds: (B:) Putative uncharacterized protein

SCOPe Domain Sequences for d3fx7b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3fx7b1 a.25.5.1 (B:5-86) automated matches {Helicobacter pylori [TaxId: 210]}
qmdteevrefvghlerfkellreevnslsnhfhnleswrdarrdkfsevldnlkstfnef
deaaqeqiawlkerirvleedy

SCOPe Domain Coordinates for d3fx7b1:

Click to download the PDB-style file with coordinates for d3fx7b1.
(The format of our PDB-style files is described here.)

Timeline for d3fx7b1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3fx7b2