SCOPe 2.01: Domain d3fx7a_: 3fx7 A:

Lineage for d3fx7a_ (3fx7 A:)

1. Root: SCOPe 2.01

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.25: Ferritin-like [47239] (6 superfamilies)
   core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection

4. Superfamily a.25.5: HP0062-like [158414] (1 family)
   (homo)dimer of alpha-hairpin subunits similar to that of the half-ferritin family; no bound metals

5. Family a.25.5.1: HP0062-like [158415] (2 proteins)
   Pfam PF09647

6. Protein automated matches [191069] (1 species)
   not a true protein

7. Species Helicobacter pylori [TaxId:210] [188975] (1 PDB entry)

8. Domain d3fx7a_: 3fx7 A: [176128]
   automated match to d2gtsa1

Details for d3fx7a_

PDB Entry: 3fx7, 1.65 Å

PDB Description: Crystal structure of hypothetical protein of HP0062 from Helicobacter pylori

PDB Compounds: (A:) Putative uncharacterized protein

SCOPe Domain Sequences for d3fx7a_:

Sequence; same for both SEQRES and ATOM records:

>d3fx7a_ a.25.5.1 (A:) automated matches {Helicobacter pylori [TaxId: 210]}
qmdteevrefvghlerfkellreevnslsnhfhnleswrdarrdkfsevldnlkstfnef
deaaqeqiawlkerirvleedyle

Timeline for d3fx7a_:

• d3fx7a_ is new in SCOPe 2.01-stable
  
• d3fx7a_ appears in SCOPe 2.02
  
• d3fx7a_ appears in the current release, SCOPe 2.08, called d3fx7a1