SCOPe 2.08: Domain d3fx7a1: 3fx7 A:5-86

Lineage for d3fx7a1 (3fx7 A:5-86)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.25: Ferritin-like [47239] (6 superfamilies)
   core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection

4. Superfamily a.25.5: HP0062-like [158414] (1 family)
   (homo)dimer of alpha-hairpin subunits similar to that of the half-ferritin family; no bound metals

5. Family a.25.5.1: HP0062-like [158415] (2 proteins)
   Pfam PF09647

6. Protein automated matches [191069] (1 species)
   not a true protein

7. Species Helicobacter pylori [TaxId:210] [188975] (1 PDB entry)

8. Domain d3fx7a1: 3fx7 A:5-86 [176128]
   Other proteins in same PDB: d3fx7a2, d3fx7b2
   automated match to d2gtsa1

Details for d3fx7a1

PDB Entry: 3fx7, 1.65 Å

PDB Description: Crystal structure of hypothetical protein of HP0062 from Helicobacter pylori

PDB Compounds: (A:) Putative uncharacterized protein

SCOPe Domain Sequences for d3fx7a1:

Sequence; same for both SEQRES and ATOM records:

>d3fx7a1 a.25.5.1 (A:5-86) automated matches {Helicobacter pylori [TaxId: 210]}
qmdteevrefvghlerfkellreevnslsnhfhnleswrdarrdkfsevldnlkstfnef
deaaqeqiawlkerirvleedy

Timeline for d3fx7a1:

• d3fx7a1 first appeared in SCOPe 2.01, called d3fx7a_
  
• d3fx7a1 appears in SCOPe 2.07